PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00135220001
Common NameGSBRNA2T00135220001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 344aa    MW: 37575 Da    PI: 8.6767
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00135220001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32193248156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00135220001 193 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 248
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.038190250IPR017930Myb domain
SuperFamilySSF466898.96E-18190251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-28191251IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26193248IPR006447Myb domain, plants
PfamPF002495.3E-8195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MENDYAQKMQ RCHEYVEALE EEQKKIQVFQ RELPLCLELV TQAIEACRKE LSSTSTTSEQ  60
CSEQTTSVSG GPVLEEFIPT KKIEENGEHE SPTPEEIGNN VDKKKSDWLR SVQLWNPSPD  120
TNEVSNPERV VGKKAKVKKR PAAVKAVASA PAVKVVASAP ATTTSSTTET CGVGKGGEEH  180
LHQQQSQSQT RRKQRRCWSP ELHRRFLHAL QQLGGSHVAT PKQIRDHMKV DGLTNDEVKS  240
HLQKYRLHTR RPATTVTAQG NGNSQQPQFM VVGGIWVPSP QDVPPPSDVA NNGGGAYAPL  300
TLQPPPQPLP PQSPKRSVER SSGRCNSQAA SSSTNTTTSS PVS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.34630.0leaf| root| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00135220001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737217.10.0PREDICTED: uncharacterized protein LOC106440164
TrEMBLA0A078CXK60.0A0A078CXK6_BRANA; BnaC02g18390D protein
STRINGBra038360.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.14e-85G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]